Sentence examples for aligns with the same from inspiring English sources

In that context, The Lego Movie aligns with the same successful techniques employed by the classic It's a Wonderful Life.

A typical example in the HIP2 database of a protein-peptide sequence comparison is how the peptide sequence 'KQSAGLVLWGAILFVAWNALLLLFFWTRPAPGRPPSVSALDGDPASLTR' is present in two proteins, IPI00000138 and IPI00179044, and aligns with the same sites of trypsin cleavage (as shown in Fig. 6).

The highest scoring alignment for each marker sequence was identified, and was considered comparative only if all high scoring alignments for that marker consistently aligned with the same region of the human genome.

Due to the variable quality in genome sequencing and the automated nature of the orthologue alignments, a residue was deemed as conserved if it aligned with the same amino acid and non-conserved if aligned with a different amino acid; for residues aligning with gaps in the alignment or X (indicating poor sequence quality), the data for that species were disregarded.

Interestingly, the TBLASTN search using the P. sitchensis CLEL16 partial protein sequence (Additional file 3: Table S2), although not full-length, revealed that this gene also aligned with the same genomic scaffold as CLEL14, but the alignment included putative protein coding segments not found in CLEL14 mapping to a long segment in NCS1 that is not shared by CLEL14 and CLEL17.

In the past, founders and employees were aligned with the same type of common stock grant, and it was the VCs who got preferential stock treatment.

In the past four presidential elections, political partisanship has become more uni-dimensional, with a higher percentage of voters tending to align with the same party on both economic and social issues — even though there is often little intrinsic relation between them.

The β-annealed Ti64 specimen showed lamellar microstructure of the colonies of acicular α platelets aligned with the same crystallographic orientation within prior β grain boundaries.

In this method, the first fixation is mapped to the closest word, and then, the following fixations are aligned with the same text line.

ChannelAdvisor, which has been independently tracking Amazon's sales numbers, says that Amazon's U.S. daily sales were up 93percentt year-over-year versus July 16th, 2014 (to align with the same day of the week a year ago), and Amazon's EU daily sales were up 53percentt.

ChannelAdvisor, which has been independently tracking Amazon's sales numbers, says that Amazon's U.S. daily sales were up 93percentt year-over-year versus July 16th, 2014 (to align with the same day of the week a year ago), and Amazon's EU daily sales were up 53percentt.