The phrase "alignment the second" is not correct and does not convey a clear meaning in written English.
It may be intended to refer to a specific alignment that is second in a sequence, but it lacks clarity and context.
Example: "In the diagram, alignment the second is crucial for understanding the overall structure."
Alternatives: "the second alignment" or "second alignment".
According to Biggs' concept of constructive alignment, the second main component in university education consists of teaching methods.
Both make use of self-alignment and while the first one validates repeats by iterative profile alignment, the second one improves the predictions applying the concept of transitivity in order to detect missed sub-optimal self-alignments.
For this, Spial takes two related sets of sequences or alignments as input and assigns each residue to one of eight possible types, depending on whether it is specific to the first alignment, the second alignment, the consensus or any combination of those (Fig. 1B).
The first stage builds a progressive alignment, the second stage that might be iterated attempts to improve the tree and builds a new progressive alignment according to this tree, and, the third stage performs iterative refinement using a variant of tree-dependent restricted partitioning.
After dedicated studies to establish timing and spatial alignment, the first results on the detector performance (efficiency, resolutions, etc).
In the 16S alignment, the sixth and seventh eigenpositions identify dissimilarities among the Fungi/Metazoa excluding the Microsporidia and the Rhodophyta and separately the Alveolata, respectively.
At the first stage we find a two-boxed signal via local multiple alignment (the first algorithm, ref. to Response to A.M #2).
For the sequence alignment, the first 45 residues (MQVSSYLRRALRRPPFPAGDANHRRLSSAPAPKPEAPAEAMPPPP) were removed from the N-terminus so that the sequence began at MPTRPW and contained 394 aa residues, consistent with the protein length predicted earlier [ 22].
If the ratio of correctly aligned bases between any such alignment and the second alignment was >0.8 and the subject regions didn't overlap, then that part was considered to be ambiguously mapped.
Three strategies were employed for variant calling: the first used the CLC Genomics Workbench 4.9 (CLC Bio) on the CLC alignments, the second used SAMtools on the TMAP alignments, and the third used the GATK variant analysis workflow on the TMAP alignments.
The alignment scorecard gives information regarding the extent of homology to each of the test species for the top scoring alignment, and the second and third most significant alignments.
