Sentence examples for alignment the first from inspiring English sources

After dedicated studies to establish timing and spatial alignment, the first results on the detector performance (efficiency, resolutions, etc).

At the first stage we find a two-boxed signal via local multiple alignment (the first algorithm, ref. to Response to A.M #2).

For the sequence alignment, the first 45 residues (MQVSSYLRRALRRPPFPAGDANHRRLSSAPAPKPEAPAEAMPPPP) were removed from the N-terminus so that the sequence began at MPTRPW and contained 394 aa residues, consistent with the protein length predicted earlier [ 22].

In the 16S alignment, the sixth and seventh eigenpositions identify dissimilarities among the Fungi/Metazoa excluding the Microsporidia and the Rhodophyta and separately the Alveolata, respectively.

According to Biggs' concept of constructive alignment, the second main component in university education consists of teaching methods.

Both make use of self-alignment and while the first one validates repeats by iterative profile alignment, the second one improves the predictions applying the concept of transitivity in order to detect missed sub-optimal self-alignments.

For this, Spial takes two related sets of sequences or alignments as input and assigns each residue to one of eight possible types, depending on whether it is specific to the first alignment, the second alignment, the consensus or any combination of those (Fig. 1B).

The slider alignment is based on two steps of exact match alignments: The first step is to align the P0_Reads table with the reference database table.

Similarly, Oliver et al. [ 23, 24] distributed the pair-wise alignment of the first step in the progressive alignment, where all pair-wise alignments are computed, on FPGA.

If the ratio of correctly aligned bases between any such alignment and the second alignment was >0.8 and the subject regions didn't overlap, then that part was considered to be ambiguously mapped.

Multiple sequence alignment was the first step in the phylogenetic analysis; alignment quality may have a significant impact on the final phylogenetic tree [ 54, 55].