Sentence examples for adsorption was reported from inspiring English sources

Chemical adsorption was reported for mild steel corrosion and physical adsorption was reported for aluminium.

The maximum adsorption was reported at pH 4.0 and equilibrium was achieved in 35 min.

The ability of activated carbon to remove Cr VI) by adsorption was reported many times.

A similar trend of rapid initial and subsequent slower adsorption was reported by many researchers [3],[3]],[3]].

As for Zn II), Pb II) adsorption is reported at calcite surfaces [20].

Further, the effects of electrical potentials of nanoparticle (ΨP) and surface (ΨS) on the adsorption are reported.

To the best of our knowledge, the electrical response of SbSI nanowires affected by CO2 adsorption is reported for the first time.

The electrooxidation of formic acid and methanol on Pt{1 1 1} in aqueous sulphuric and perchloric acid as a function of both palladium coverage and Nafion adsorption is reported.

Limited surface adsorption is reported for triflate (BMIMOTf) and chloride anions (DES), the latter being fully removed upon calcination, while PF6− (BMIMPF6) remains adsorbed on the surface during Au NPs deposition and leads to POxδ− and F− surface species upon calcination.

Total adsorption is reported as mg of dye per gram of biomass.

When peptide adsorptions were reported, serum was incubated with a consensus clade B V3 peptide (CTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC) at 25 µg/mL for 1 hr at 37°C prior to the addition of virus.