Sentence examples similar to according to reference number from inspiring English sources

All probes and primers were designed according to reference GenBank accession numbers of AF273215 (IHHNV), AF440570.1 (WSSV) and DQ021452 (Shrimp elongation factor).

The dog population per veterinary surgeon was estimated according to reference figures (i.e. number of companion animal veterinarians and number of dogs per administrative department in France) and the annual incidence rate of canine babesiosis was calculated per geographic area.

Briefly, a segment of the mtDNA in the minor arc was amplified using primers 3922F24 and 4036R26 (first number, 5′ nucleotide of primer; second number, length of primer; F, forward primer; R, reverse primer; numbering according to reference sequence NC_012920).

The synthetic V3 loop peptide represented the V3 sequence of strain IIIB (amino acids AA 297 330; numbering according to reference 44, TRPNNNTRKSIRIQRGPGRAFVTIGKIGNMRQAH.

Site-directed mutagenesis and computer-based docking studies of the TIR domains of TLR1 and TLR2 revealed an interaction between Gly-676 (numbering according to reference [ 23] and corresponding to position 685 [see Additional file 1]) of the TLR1 BB loop with residues Arg-748 and Phe-749 of the TLR2 DD loop [ 23].

Embryos were staged according to reference [33].

The preparation was performed according to reference [61].

It's not known if they were former students of Odessa's School Number 56, but according to references to the story in Russian news, that's where they found the entrance to the mines.

The XRD patterns for both samples are indexed according to ICDD reference number 01-0178-0430 showing a MgO cubic crystal structure of space group Fm-3 m.

Ethical approval from the Regional Ethics Committee in Linköping obtained according to Swedish Biobank Law (Reference number: 2010/311 31).

Literature references are according to main text reference numbering.