according to reference

USAGE SUMMARY

The phrase "according to reference" is correct and can be used in written English.
It is typically used to indicate that information or a statement is taken from a specific source or reference. Example: According to reference, the population of the city has doubled in the last decade. This means that the information about the population growth is based on a specific source, such as a census report or an article from a reputable publication.

✓ Grammatically correct

Science

News & Media

Formal & Business

Human-verified examples from authoritative sources

Exact Expressions

59 human-written examples

Grouts with perlite (PRL) and blast furnace slag (BFS) showed the similar strength values according to reference grout.

Construction and Building Materials

The synthetic V3 loop peptide represented the V3 sequence of strain IIIB (amino acids AA 297 330; numbering according to reference 44, TRPNNNTRKSIRIQRGPGRAFVTIGKIGNMRQAH.

Nature

Polymer blended concrete having a lower thermal conductivity of 57.8% according to reference concrete has been achieved with a 28-day compressive strength loss of 40.2%.

Construction and Building Materials

A processing chain is proposed to realize indicator calculation and urban fabric classification for any french municipality according to reference data provided by the French National Geographical Institute (IGN).

Urban Climate

In conclusion, 3D β-cell spheroids from a cultured cell line can be used in HTS assays that, according to reference drugs tested here, are sensitive and predictive of the in vivo response.

Journal of Pharmacological and Toxicological Methods

The data were simulated according to reference [46].

Journal of Cheminformatics

Fe3O4 magnetite nanoparticles were synthesized according to reference [28].

Nanoscale Research Letters

OH-terminated Ag NPs were synthesized as building blocks according to reference [7].

Nanoscale Research Letters

The electrical parameters of PEDOT PSS were defined according to reference [32].

Nanoscale Research Letters

The diagonals represent the sites classified correctly according to reference data.

Environmental Systems Research

Note that the frequency of the dither signal was determined according to reference [14].

ROBOMECH Journal

Expert writing Tips

Best practice

When using "according to reference", ensure the reference is clearly identified and accessible to the reader for verification.

Common error

Avoid using "according to reference" without specifying which reference you are referring to. Always provide enough information for readers to locate the source.

Linguistic Context

The phrase "according to reference" functions as a prepositional phrase introducing information derived from a specific source. It provides attribution and indicates that the subsequent statement is supported by the cited material. Ludwig AI shows that this phrase is commonly used in scientific and technical writing.

Expression frequency: Very common

Frequent in

Science

74%

News & Media

15%

Formal & Business

11%

Less common in

Encyclopedias

0%

Wiki

0%

Reference

0%

Ludwig's WRAP-UP

The phrase "according to reference" is a grammatically sound and frequently employed prepositional phrase, as affirmed by Ludwig AI. Its primary function is to introduce information sourced from a specific reference, thereby providing attribution and bolstering the credibility of claims. Predominantly utilized in formal, scientific, and technical registers, this phrase underscores the importance of source verification and precise citation. While variations like "as the reference indicates" and "based on the referenced data" offer nuanced alternatives, the core purpose remains consistent: to anchor information in authoritative sources. Ensure clarity by specifying the exact reference to avoid ambiguity.

More alternative expressions

Phrases that express similar concepts, ordered by semantic similarity:

as the reference indicates

Focuses on the reference material directly providing the information.

based on the referenced data

Emphasizes that the information is grounded in specific data points from the reference.

in line with the reference material

Highlights that the information aligns with the overall content of the reference.

following the reference's guidelines

Indicates adherence to specific instructions or recommendations from the reference.

pursuant to the reference

A more formal way of saying "according to", often used in legal or official contexts.

as per the cited reference

Emphasizes that the information comes from a specific, cited source.

drawing from the reference

Suggests that the information is extracted or inferred from the reference.

consistent with the reference

Highlights that the information agrees with the details provided in the reference.

in accordance with the reference

A formal phrase suggesting that something is done following the rules or details of the reference.

by the authority of the reference

Emphasizes that the information is backed by the credibility of the reference.

FAQs

How can I use "according to reference" in a sentence?

You can use "according to reference" to introduce information or data that originates from a specific source. For example, "According to reference [25], the average solar radiation in these states indicates the high potential of SPV".

What are some alternatives to "according to reference"?

You can use alternatives like "as the reference indicates", "based on the referenced data", or "in line with the reference material".

Is it necessary to always cite the reference after using "according to reference"?

Yes, it is crucial to cite the reference immediately after using the phrase to give credit to the original source and allow readers to verify the information.

What kind of sources are suitable for using "according to reference"?

This phrase is suitable for academic papers, research reports, and technical documents where citing sources is important. It's less common in informal writing.